spacer

EBI Dbfetch

ID   HLA08964; SV 1; standard; DNA; HUM; 546 BP.
XX
AC   HLA08964;
XX
SV   HLA08964.1
XX
DT   31-DEC-2012 (Rel. 3.11.0, Created, Version 1)
DT   22-APR-2015 (Rel. 3.20.0, Last Updated, Version 1)
XX
DE   HLA-A*24:228, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-A; Allele; HLA-A*24:228;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.20.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-546
RX   PUBMED; 24571476.
RA   Hernandez-Frederick CJ, Giani AS, Cereb N, Silva-Gozalez R, Pingel J,
RA   Schmidt AH, Ehninger G, Yang SY;
RT   "Identification of 2127 new HLA class I alleles in potential stem cell
RT   donors from Germany, the United States and Poland.";
RL   Tissue Antigens 83:184-189(2014).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JX508847; JX508847.0.
DR   EMBL; JX970494; JX970494.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00005201"
FT                   /cell_line="HG00005202"
FT   CDS             <1..546>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:228"
FT                   /product="MHC Class I HLA-A*24:228 sequence"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKHKWEAAHVAEQLRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
SQ   Sequence 546 BP; 111 A; 164 C; 193 G; 78 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg gttctcacac cctccagatg atgtttggct       300
     gcgacgtggg gtcggacggg cgcttcctcc gcgggtacca ccagtacgcc tacgacggca       360
     aggattacat cgccctgaaa gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccaa gcacaagtgg gaggcggccc atgtggcgga gcagttgaga gcctacctgg       480
     agggcacgtg cgtggacggg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//


spacer
spacer