Dbfetch

ID   HLA08958; SV 1; standard; DNA; HUM; 954 BP.
XX
AC   HLA08958;
XX
SV   HLA08958.1
XX
DT   30-NOV-2012 (Rel. 3.11.0, Created, Version 1)
DT   10-NOV-2017 (Rel. 3.30.0, Last Updated, Version 1)
XX
DE   MICA*007:05, Human MHC Class I chain-related gene (partial)
XX
KW   Human MHC; Class I chain-related gene; MICA; Allele; MICA*007:05;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.30.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; KC171730; KC171730.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..954
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="2382P07207725"
FT   CDS             join(1..255,256..543,544..822,823..954)
FT                   /codon_start=1
FT                   /partial
FT                   /gene="MICA"
FT                   /allele="MICA*007:05"
FT                   /product="MHC Class I chain-related MICA*007:05 sequence"
FT                   /translation="PHSLRYNLTVLSWDGSVQSGFLAEVHLDGQPFLRCDRQKCRAKPQ
FT                   GQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTR
FT                   SSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADC
FT                   LQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSL
FT                   SHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQS
FT                   HWQTFHVSAVAAAAIFVIIIFYVRCCKKKTSAAEGP"
FT   exon            1..255
FT                   /number="2"
FT   exon            256..543
FT                   /number="3"
FT   exon            544..822
FT                   /number="4"
FT   exon            823..954
FT                   /number="5"
SQ   Sequence 954 BP; 242 A; 239 C; 267 G; 206 T; 0 other;
     agccccacag tcttcgttat aacctcacgg tgctgtcctg ggatggatct gtgcagtcag        60
     ggtttctcgc tgaggtacat ctggatggtc agcccttcct gcgctgtgac aggcagaaat       120
     gcagggcaaa gccccaggga cagtgggcag aagatgtcct gggaaataag acatgggaca       180
     gagagaccag ggacttgaca gggaatggaa aggacctcag gatgaccctg gctcatatca       240
     aggaccagaa agaaggcttg cattccctcc aggagattag ggtctgtgag atccatgaag       300
     acaacagcac caggagctcc cagcatttct actacgatgg ggagctcttc ctctcccaaa       360
     acctggagac tgaggaatgg acaatgcccc agtcctccag agctcagacc ttggccatga       420
     acgtcaggaa tttcttgaag gaagatgcca tgaagaccaa gacacactat cacgctatgc       480
     atgcagactg cctgcaggaa ctacggcgat atctaaaatc cggcgtagtc ctgaggagaa       540
     cagtgccccc catggtgaat gtcacccgca gtgaggcctc agagggcaac attaccgtga       600
     catgcagggc ttctggcttc tatccctgga atatcacact gagctggcgt caggatgggg       660
     tatctttgag ccacgacacc cagcagtggg gggatgtcct gcctgatggg aatggaacct       720
     accagacctg ggtggccacc aggatttgcc aaggagagga gcagaggttc acctgctaca       780
     tggaacacag cgggaatcac agcactcacc ctgtgccctc tgggaaagtg ctggtgcttc       840
     agagtcattg gcagacattc catgtttctg ctgttgctgc tgctgctatt tttgttatta       900
     ttattttcta tgtccgttgt tgtaagaaga aaacatcagc tgcagagggt ccag             954
//