Dbfetch

ID   HLA08904; SV 1; standard; DNA; HUM; 270 BP.
XX
AC   HLA08904;
XX
SV   HLA08904.1
XX
DT   31-OCT-2012 (Rel. 3.11.0, Created, Version 1)
DT   10-NOV-2017 (Rel. 3.30.0, Last Updated, Version 1)
XX
DE   HLA-DRB1*16:01:03, Human MHC Class II sequence (partial)
XX
KW   Human MHC; HLA; Class II; HLA-DRB1; Allele; HLA-DRB1*16:01:03;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.30.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; HF545603; HF545603.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="CBRA5912608995-"
FT   CDS             1..270
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*16:01:03"
FT                   /product="MHC Class II HLA-DRB1*16:01:03 sequence"
FT                   /translation="RFLWQPKRECHFFNGTERVRFLDRYFYNQEESVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDFLEDRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /number="2"
SQ   Sequence 270 BP; 57 A; 65 C; 100 G; 48 T; 0 other;
     cacgtttcct gtggcagcct aagagggagt gtcatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccagg aggagtcggt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgacgc tgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//