spacer

EBI Dbfetch

ID   HLA08890; SV 1; standard; DNA; HUM; 270 BP.
XX
AC   HLA08890;
XX
SV   HLA08890.1
XX
DT   31-OCT-2012 (Rel. 3.11.0, Created, Version 1)
DT   10-OCT-2014 (Rel. 3.18.0, Last Updated, Version 1)
XX
DE   HLA-DRB1*14:136, Human MHC Class II sequence (partial)
XX
KW   Human MHC; HLA; Class II; HLA-DRB1; Allele; HLA-DRB1*14:136;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.18.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-270
RX   PUBMED; 23510427.
RA   Park H, Lee YJ, Han BY, Song EY, Park MH;
RT   "A novel HLA-DRB1*14 allele, HLA-DRB1*14:136, identified from a registered
RT   marrow donor in Korea.";
RL   Tissue Antigens 81:239-240(2013).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JX966389; JX966389.0.
DR   EMBL; KF432139; KF432139.0.
DR   EMBL; KF432140; KF432140.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Oriental"
FT                   /cell_line="01-32450"
FT                   /cell_line="13-77"
FT   CDS             <1..270>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14:136"
FT                   /product="MHC Class II HLA-DRB1*14:136 sequence"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRALVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /number="2"
SQ   Sequence 270 BP; 55 A; 65 C; 98 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer