spacer

EBI Dbfetch

ID   HLA08855; SV 1; standard; DNA; HUM; 270 BP.
XX
AC   HLA08855;
XX
SV   HLA08855.1
XX
DT   31-OCT-2012 (Rel. 3.11.0, Created, Version 1)
DT   10-OCT-2014 (Rel. 3.18.0, Last Updated, Version 1)
XX
DE   HLA-DRB1*08:50, Human MHC Class II sequence (partial)
XX
KW   Human MHC; HLA; Class II; HLA-DRB1; Allele; HLA-DRB1*08:50;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.18.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JX188045; JX188045.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00004738"
FT   CDS             <1..270>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*08:50"
FT                   /product="MHC Class II HLA-DRB1*08:50 sequence"
FT                   /translation="RFLEYSTGECYFFNGTERVRFLDRYFYNQEEYVRFHSDVGEYRAV
FT                   TELGRPSAEYWNSQKDFLEDRRALVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /number="2"
SQ   Sequence 270 BP; 57 A; 64 C; 97 G; 52 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tataaccaag aggagtacgt gcgcttccac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctagcgc cgagtactgg aacagccaga       180
     aggacttcct ggaagacagg cgggccctgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacggtg cagcggcgag                                        270
//


spacer
spacer