spacer

EBI Dbfetch

ID   HLA08851; SV 1; standard; DNA; HUM; 270 BP.
XX
AC   HLA08851;
XX
SV   HLA08851.1
XX
DT   31-OCT-2012 (Rel. 3.11.0, Created, Version 1)
DT   17-JUL-2014 (Rel. 3.17.0, Last Updated, Version 1)
XX
DE   HLA-DRB1*04:04:08, Human MHC Class II sequence (partial)
XX
KW   Human MHC; HLA; Class II; HLA-DRB1; Allele; HLA-DRB1*04:04:08;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.17.0 - Updated 21-AUG-2014
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ824776; JQ824776.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00004733"
FT   CDS             <1..270>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04:04:08"
FT                   /product="MHC Class II HLA-DRB1*04:04:08 sequence"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQRRAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /number="2"
SQ   Sequence 270 BP; 59 A; 64 C; 99 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagagg cgggcggcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer