Dbfetch

ID   HLA08840; SV 1; standard; DNA; HUM; 270 BP.
XX
AC   HLA08840;
XX
SV   HLA08840.1
XX
DT   31-OCT-2012 (Rel. 3.11.0, Created, Version 1)
DT   10-NOV-2017 (Rel. 3.30.0, Last Updated, Version 1)
XX
DE   HLA-DRB1*04:134, Human MHC Class II sequence (partial)
XX
KW   Human MHC; HLA; Class II; HLA-DRB1; Allele; HLA-DRB1*04:134;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.30.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-270
RX   PUBMED; 25220445.
RA   Hernandez-Frederick CJ, Cereb N, Giani AS, Ruppel J, Maraszek A, Pingel J,
RA   Sauter J, Schmidt AH, Yang SY;
RT   "Three hundred and seventy-two novel HLA class II alleles identified in
RT   potential hematopoietic stem cell donors from Germany, the United States,
RT   and Poland.";
RL   Tissue Antigens 84:497-502(2014).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ824805; JQ824805.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Caucasoid"
FT                   /cell_line="HG00004719"
FT   CDS             1..270
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04:134"
FT                   /product="MHC Class II HLA-DRB1*04:134 sequence"
FT                   /translation="RFLEQVKHEYHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDERAAVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /number="2"
SQ   Sequence 270 BP; 62 A; 64 C; 96 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt atcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacatcct ggaagacgag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//