Dbfetch

ID   HLA08827; SV 2; standard; DNA; HUM; 3349 BP.
XX
AC   HLA08827;
XX
SV   HLA08827.2
XX
DT   31-OCT-2012 (Rel. 3.11.0, Created, Version 1)
DT   10-NOV-2017 (Rel. 3.30.0, Last Updated, Version 2)
XX
DE   HLA-C*04:01:44, Human MHC Class I sequence
XX
KW   Human MHC; HLA; Class I; HLA-C; Allele; HLA-C*04:01:44;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.30.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-3349
RX   PUBMED; 24571476.
RA   Hernandez-Frederick CJ, Giani AS, Cereb N, Silva-Gozalez R, Pingel J,
RA   Schmidt AH, Ehninger G, Yang SY;
RT   "Identification of 2127 new HLA class I alleles in potential stem cell
RT   donors from Germany, the United States and Poland.";
RL   Tissue Antigens 83:184-189(2014).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ824486; JQ824486.0.
DR   EMBL; JQ911898; JQ911898.0.
DR   EMBL; LN877316; LN877316.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3349
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="AN300114"
FT                   /cell_line="HG00004700"
FT                   /cell_line="HG00004701"
FT   CDS             join(284..356,487..756,1003..1278,1866..2141,2822..2854,
FT                   2962..3009,3174..3178)
FT                   /codon_start=1
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*04:01:44"
FT                   /product="MHC Class I HLA-C*04:01:44 sequence"
FT                   /translation="MRVMAPRTLILLLSGALALTETWAGSHSMRYFSTSVSWPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPRGEPREPWVEQEGPEYWDRETQKYKRQAQADRVNLRK
FT                   LRGYYNQSEDGSHTLQRMFGCDLGPDGRLLRGYNQFAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAAREAEQRRAYLEGTCVEWLRRYLENGKETLQRAEHPKTHVTHHPVSDHE
FT                   ATLRCWALGFYPAEITLTWQWDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPEPLTLRWKPSSQPTIPIVGIVAGLAVLAVLAVLGAMVAVVMCRRKSSGG
FT                   KGGSCSQAASSNSAQGSDESLIACKA"
FT   UTR             1..283
FT   exon            284..356
FT                   /number="1"
FT   intron          357..486
FT                   /number="1"
FT   exon            487..756
FT                   /number="2"
FT   intron          757..1002
FT                   /number="2"
FT   exon            1003..1278
FT                   /number="3"
FT   intron          1279..1865
FT                   /number="3"
FT   exon            1866..2141
FT                   /number="4"
FT   intron          2142..2262
FT                   /number="4"
FT   exon            2263..2382
FT                   /number="5"
FT                   /pseudo
FT   intron          2383..2821
FT                   /number="5"
FT   exon            2822..2854
FT                   /number="6"
FT   intron          2855..2961
FT                   /number="6"
FT   exon            2962..3009
FT                   /number="7"
FT   intron          3010..3173
FT                   /number="7"
FT   exon            3174..3178
FT                   /number="8"
FT   UTR             3179..3349
SQ   Sequence 3349 BP; 628 A; 973 C; 1045 G; 703 T; 0 other;
     aatcaggacg aagtcccagg tcccgggcgg ggctctcagg gtctcaggct ccaagggccg        60
     tgtctgcact ggggaggcgc cgcgttgggg attctccact cccctgagtt tcacttcttc       120
     tcccaacctg cgtcgggtcc ttcttcctga atactcatga cgcgtcccca attcccactc       180
     ccattgggtg tcgggttcta gagaagccaa tcagcgtctc cgcagtcccg gttctaaagt       240
     ccccagtcac ccacccggac tcagattctc cccagacgcc gagatgcggg tcatggcgcc       300
     ccgaaccctc atcctgctgc tctcgggagc cctggccctg accgagacct gggccggtga       360
     gtgcggggtt gggagggaaa cggcctctgg ggagaggagc gaggggcccg cccggcgagg       420
     gcgcaggacc cggggagccg cgcagggagg agggtcgggc gggtctcagc cactcctcgt       480
     ccccaggctc ccactccatg aggtatttct ccacatccgt gtcctggccc ggccgcgggg       540
     agccccgctt catcgcagtg ggctacgtgg acgacacgca gttcgtgcgg ttcgacagcg       600
     acgccgcgag tccaagaggg gagccgcggg agccgtgggt ggagcaggag gggccggagt       660
     attgggaccg ggagacacag aagtacaagc gccaggcaca ggctgaccga gtgaacctgc       720
     ggaaactgcg cggctactac aaccagagcg aggacggtga gtgaccccgg cccggggcgc       780
     aggtcacgac ccctccccat cccccacgga cggcccgggt cgccccgagt ctccccgtct       840
     gagatccacc ccgaggctgc ggaacccgcc cagaccctcg accggagaga gccccagtca       900
     cctttacccg gtttcatttt cagtttaggc caaaatcccc gcgggttggt cgggactggg       960
     gcggggctcg ggggaccggg ctgaccacgg gggcggggcc agggtctcac accctccaga      1020
     ggatgtttgg ctgcgacctg gggccggacg ggcgcctcct ccgcgggtat aaccagttcg      1080
     cctacgacgg caaggattac atcgccctga acgaggatct gcgctcctgg accgccgcgg      1140
     acacggcggc tcagatcacc cagcgcaagt gggaggcggc tcgtgaggcg gagcagcgga      1200
     gagcctacct ggagggcacg tgcgtggagt ggctccgcag atacctggag aacgggaagg      1260
     agacgctgca gcgcgcgggt accaggggca gtggggagcc ttccccatct cccgtagatc      1320
     tcccgggatg gcctcccacg aggaggggag gaaaatggga tcagcgctag aatatcgccc      1380
     tcccttgaat ggagaatggg atgagttttc ctgagtttcc tctgagggcc ccctctgctc      1440
     tctaggacaa ttaagggatg aagtccttga ggaaatggag gggaagacag tccctggaat      1500
     actgatcagg ggtccccttt gaccactttg accactgcag cagctgtggt caggctgctg      1560
     acctttctct caggccttgt tctctgcctg acgctcaatg tgtttgaagg tttgattcca      1620
     gcttttctga gtccttcggc ctccactcag gtcaggacca gaagtcgctg ttcctccctc      1680
     agagactaga actttccaat gaataggaga ttatcccagg tgcctgtgtc caggctggcg      1740
     tctgggttct gtgccccctt ccccacccca ggtgtcctgt ccattctcag gatggtcaca      1800
     tgggcgctgt tggagtgtcg caagagagat acaaagtgtc tgaattttct gactcttccc      1860
     atcagaacac ccaaagacac acgtgaccca ccatcccgtc tctgaccatg aggccaccct      1920
     gaggtgctgg gccctgggct tctaccctgc ggagatcaca ctgacctggc agtgggatgg      1980
     ggaggaccaa actcaggaca ccgagcttgt ggagaccagg ccagcaggag atggaacctt      2040
     ccagaagtgg gcagctgtgg tggtgccttc tggagaagag cagagataca cgtgccatgt      2100
     tcagcacgag gggctgccgg agcccctcac cctgagatgg agtaaggagg gggatgaggg      2160
     gtgatgtgtc ttctcaggga aagcagaagt cctggagccc ttcagccggg tcagggctga      2220
     ggcttggagg tcagggcccc tcaccttccc ctcctttccc agagccgtct tcccagccca      2280
     ccatccccat cgtgggcatc gttgctggcc tggctgtcct ggctgtccta gctgtcctag      2340
     gagctatggt ggctgttgtg atgtgtagga ggaagagctc aggtagggaa ggggtgagga      2400
     gtggggtctg ggttttcttg ttccactggg agtttcaagc cccaggtaga agtgtgcccc      2460
     acctcgttac tggaagcacc atccacacat gggccatccc agcctgggac cctgtgtgcc      2520
     agcacttact ctgttgtgaa gcacatgaca atgaaggaca gatgtatcac cttgatgatt      2580
     atggtgttgg ggtccttgat tccagcattc atgagtcagg ggaaggtccc tgctaaggac      2640
     agaccttagg agggcagttg cttcagaacc cacagctgct ttccccgtgt ttcctgatcc      2700
     tgccctgggt ctgcagtcat agttctggaa acttctcttg ggtccaagac taggaggttc      2760
     ccctaagatc gcatggccct gcctcctccc tgtcccctca cagggcattt tcttcccaca      2820
     ggtggaaaag gagggagctg ctctcaggct gcgtgtaagt gatggcggtg ggcgtgtgga      2880
     ggagctcacc caccccataa ttcctcttgt cccacatctc ctgcgggctc tgaccaggtc      2940
     tttttttttg ttctacccca gccagcaaca gtgcccaggg ctctgatgag tctctcatcg      3000
     cttgtaaagg tgagattctg gggagctgaa gtggtcgggg gtggggcaga gggaaaaggc      3060
     ctaggtaatg gggatccttt gattgggacg tttcgaatgt gtggtgagct gttcagagtg      3120
     tcatcactta ccatgactga cctgaatttg ttcatgacta ttgtgttctg tagcctgaga      3180
     cagctgcctg tgtgggactg agatgcagga tttcttcaca cctctccttt gtgacttcaa      3240
     gagcctctgg catctctttc tgcaaaggca tctgaatgtg tctgcgttcc tgttagcata      3300
     atgtgaggag gtggagagac agcccacccc cgtgtccacc gtgacccct                  3349
//