spacer

EBI Dbfetch

ID   HLA08816; SV 1; standard; DNA; HUM; 546 BP.
XX
AC   HLA08816;
XX
SV   HLA08816.1
XX
DT   31-OCT-2012 (Rel. 3.11.0, Created, Version 1)
DT   17-JUL-2014 (Rel. 3.17.0, Last Updated, Version 1)
XX
DE   HLA-C*03:180, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-C; Allele; HLA-C*03:180;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.17.0 - Updated 21-AUG-2014
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-546
RX   PUBMED; 24571476.
RA   Hernandez-Frederick CJ, Giani AS, Cereb N, Silva-Gozalez R, Pingel J,
RA   Schmidt AH, Ehninger G, Yang SY;
RT   "Identification of 2127 new HLA class I alleles in potential stem cell
RT   donors from Germany, the United States and Poland.";
RL   Tissue Antigens 83:184-189(2014).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ867330; JQ867330.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Caucasoid"
FT                   /cell_line="HG00004687"
FT   CDS             <1..546>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*03:180"
FT                   /product="MHC Class I HLA-C*03:180 sequence"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASLRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
SQ   Sequence 546 BP; 107 A; 164 C; 200 G; 75 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtctgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg ggtctcacat catccagagg atgtatggct       300
     gcgacgtggg gcccgacggg cgcctcctcc gcgggtatga ccagtacgcc tacgacggca       360
     aggattacat cgccctgaac gaggatctgc gctcctggac cgccgcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctgaagaa tgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//


spacer
spacer