spacer

EBI Dbfetch

ID   HLA08776; SV 1; standard; DNA; HUM; 895 BP.
XX
AC   HLA08776;
XX
SV   HLA08776.1
XX
DT   30-SEP-2012 (Rel. 3.10.0, Created, Version 1)
DT   22-APR-2015 (Rel. 3.20.0, Last Updated, Version 1)
XX
DE   HLA-B*08:01:20, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-B; Allele; HLA-B*08:01:20;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.20.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; HE974341; HE974341.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..895
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="FRF1658"
FT   CDS             <1..895>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08:01:20"
FT                   /product="MHC Class I HLA-B*08:01:20 sequence"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            1..73
FT                   /number="1"
FT   exon            74..343
FT                   /number="2"
FT   exon            344..619
FT                   /number="3"
FT   exon            620..895
FT                   /number="4"
SQ   Sequence 895 BP; 190 A; 287 C; 295 G; 123 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctactct cggcggccct ggccctgacc        60
     gagacctggg ccggctccca ctccatgagg tatttcgaca ccgccatgtc ccggcccggc       120
     cgcggggagc cccgcttcat ctcagtgggc tacgtggacg acacgcagtt cgtgaggttc       180
     gacagcgacg ccgcgagtcc gagagaggag ccgcgggcgc cgtggataga gcaggagggg       240
     ccggagtatt gggaccggaa cacacagatc ttcaagacca acacacagac tgaccgagag       300
     agcctgcgga acctgcgcgg ctactacaac cagagcgagg ccgggtctca caccctccag       360
     agcatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca taaccagtac       420
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgcgctcctg gaccgcggcg       480
     gacaccgcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcaggac       540
     agagcctacc tggagggcac gtgcgtggag tggctccgca gatacctgga gaacgggaag       600
     gacacgctgg agcgcgcgga ccccccaaag acacacgtga cccaccaccc catctctgac       660
     catgaggcca ccctgaggtg ctgggccctg ggcttctacc ctgcggagat cacactgacc       720
     tggcagcggg atggcgagga ccaaactcag gacactgagc ttgtggagac cagaccagca       780
     ggagatagaa ccttccagaa gtgggcagct gtggtggtgc cttctggaga agagcagaga       840
     tacacatgcc atgtacagca tgaggggctg ccgaagcccc tcaccctgag atggg            895
//


spacer
spacer