spacer

EBI Dbfetch

ID   HLA08721; SV 1; standard; DNA; HUM; 546 BP.
XX
AC   HLA08721;
XX
SV   HLA08721.1
XX
DT   30-SEP-2012 (Rel. 3.10.0, Created, Version 1)
DT   10-OCT-2014 (Rel. 3.18.0, Last Updated, Version 1)
XX
DE   HLA-C*07:02:37, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-C; Allele; HLA-C*07:02:37;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.18.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ824600; JQ824600.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00004630"
FT   CDS             <1..546>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:02:37"
FT                   /product="MHC Class I HLA-C*07:02:37 sequence"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
SQ   Sequence 546 BP; 104 A; 173 C; 198 G; 71 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg ggtctcacac cctccagagg atgtctggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggat accgcggctc       420
     agatcaccca gcgcaagttg gaggcggccc gtgcggcgga gcagctgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcag                                                                  546
//


spacer
spacer