Dbfetch

ID   HLA08717; SV 1; standard; DNA; HUM; 546 BP.
XX
AC   HLA08717;
XX
SV   HLA08717.1
XX
DT   30-SEP-2012 (Rel. 3.10.0, Created, Version 1)
DT   10-NOV-2017 (Rel. 3.30.0, Last Updated, Version 1)
XX
DE   HLA-C*07:286, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-C; Allele; HLA-C*07:286;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.30.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-546
RX   PUBMED; 24571476.
RA   Hernandez-Frederick CJ, Giani AS, Cereb N, Silva-Gozalez R, Pingel J,
RA   Schmidt AH, Ehninger G, Yang SY;
RT   "Identification of 2127 new HLA class I alleles in potential stem cell
RT   donors from Germany, the United States and Poland.";
RL   Tissue Antigens 83:184-189(2014).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JX458895; JX458895.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00004626"
FT   CDS             join(1..270,271..546)
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07:286"
FT                   /product="MHC Class I HLA-C*07:286 sequence"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMSGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGRETLQRA"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
SQ   Sequence 546 BP; 103 A; 174 C; 199 G; 70 T; 0 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg ggtctcacac cctccagagg atgtctggct       300
     gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac accgcggctc       420
     agatcaccca gcgcaagttg gaggcggccc gtgcggcgga gcagctgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggagggag acgctgcagc       540
     gcgcag                                                                  546
//