Dbfetch

ID   HLA08514; SV 1; standard; DNA; HUM; 546 BP.
XX
AC   HLA08514;
XX
SV   HLA08514.1
XX
DT   31-AUG-2012 (Rel. 3.10.0, Created, Version 1)
DT   16-APR-2018 (Rel. 3.32.0, Last Updated, Version 1)
XX
DE   HLA-B*15:260, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-B; Allele; HLA-B*15:260;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.32.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-546
RX   PUBMED; 24571476.
RA   Hernandez-Frederick CJ, Giani AS, Cereb N, Silva-Gozalez R, Pingel J,
RA   Schmidt AH, Ehninger G, Yang SY;
RT   "Identification of 2127 new HLA class I alleles in potential stem cell
RT   donors from Germany, the United States and Poland.";
RL   Tissue Antigens 83:184-189(2014).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ997126; JQ997126.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00004250"
FT   CDS             join(<1..270,271..546)
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15:260"
FT                   /product="MHC Class I HLA-B*15:260 sequence"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQERPEYWDRETQISKTNTQTYRESLRNLRGHYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
SQ   Sequence 546 BP; 111 A; 174 C; 192 G; 69 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gatggcgccc cgggcgccat ggatagagca ggagaggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcca ctacaaccag agcgaggccg ggtctcacac cctccagagg atgtacggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcatga ccagtccgcc tacgacggca       360
     aggattacat cgccctgaac gaggacctga gctcctggac cgcggcggac acggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagtggaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//