spacer

EBI Dbfetch

ID   HLA08495; SV 1; standard; DNA; HUM; 546 BP.
XX
AC   HLA08495;
XX
SV   HLA08495.1
XX
DT   31-AUG-2012 (Rel. 3.10.0, Created, Version 1)
DT   17-JUL-2014 (Rel. 3.17.0, Last Updated, Version 1)
XX
DE   HLA-A*02:384, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-A; Allele; HLA-A*02:384;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.17.0 - Updated 21-AUG-2014
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JX089353; JX089353.0.
DR   EMBL; KC296456; KC296456.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Black"
FT                   /cell_line="BY00978"
FT                   /cell_line="HG00004285"
FT   CDS             <1..546>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:384"
FT                   /product="MHC Class I HLA-A*02:384 sequence"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEAGSHTVQRMYGCDVGS
FT                   DWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQTTKHKWEAAHVAEQLRAYLEGTC
FT                   VEWLRRYLENGKEALQRT"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
SQ   Sequence 546 BP; 110 A; 161 C; 195 G; 80 T; 0 other;
     gctctcactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagggtccg gagtattggg       180
     acggggagac acggaaagtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gttctcacac cgtccagagg atgtatggct       300
     gcgacgtggg gtcggactgg cgcttcctcc gcgggtacca ccagtacgcc tacgacggca       360
     aggattacat cgccctgaaa gaggacctgc gctcttggac cgcggcggac atggcagctc       420
     agaccaccaa gcacaagtgg gaggcggccc atgtggcgga gcagttgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag gcgctgcagc       540
     gcacgg                                                                  546
//


spacer
spacer