Dbfetch

ID   HLA08466; SV 2; standard; DNA; HUM; 3314 BP.
XX
AC   HLA08466;
XX
SV   HLA08466.2
XX
DT   31-AUG-2012 (Rel. 3.10.0, Created, Version 1)
DT   19-JAN-2018 (Rel. 3.31.0, Last Updated, Version 2)
XX
DE   HLA-A*02:380, Human MHC Class I sequence
XX
KW   Human MHC; HLA; Class I; HLA-A; Allele; HLA-A*02:380;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.31.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-3314
RX   PUBMED; 24571476.
RA   Hernandez-Frederick CJ, Giani AS, Cereb N, Silva-Gozalez R, Pingel J,
RA   Schmidt AH, Ehninger G, Yang SY;
RT   "Identification of 2127 new HLA class I alleles in potential stem cell
RT   donors from Germany, the United States and Poland.";
RL   Tissue Antigens 83:184-189(2014).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ739465; JQ739465.0.
DR   EMBL; KC155585; KC155585.0.
DR   EMBL; KC185422; KC185422.0.
DR   EMBL; KF673195; KF673195.0.
DR   EMBL; KF804106; KF804106.0.
DR   EMBL; KF840735; KF840735.0.
DR   EMBL; LT908358; LT908358.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3314
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Mixed"
FT                   /cell_line="AN00684"
FT                   /cell_line="HG00004139"
FT                   /cell_line="HG00006496"
FT                   /cell_line="HG00006497"
FT                   /cell_line="HG00007573"
FT                   /cell_line="HG00008084"
FT                   /cell_line="HG00008085"
FT   CDS             join(301..373,504..773,1015..1290,1891..2166,2266..2382,
FT                   2821..2853,2996..3043,3213..3217)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02:380"
FT                   /product="MHC Class I HLA-A*02:380 sequence"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGT
FT                   LRGYYNQSEAGSHTVQRMYGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAADMV
FT                   AQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   UTR             1..300
FT   exon            301..373
FT                   /number="1"
FT   intron          374..503
FT                   /number="1"
FT   exon            504..773
FT                   /number="2"
FT   intron          774..1014
FT                   /number="2"
FT   exon            1015..1290
FT                   /number="3"
FT   intron          1291..1890
FT                   /number="3"
FT   exon            1891..2166
FT                   /number="4"
FT   intron          2167..2265
FT                   /number="4"
FT   exon            2266..2382
FT                   /number="5"
FT   intron          2383..2820
FT                   /number="5"
FT   exon            2821..2853
FT                   /number="6"
FT   intron          2854..2995
FT                   /number="6"
FT   exon            2996..3043
FT                   /number="7"
FT   intron          3044..3212
FT                   /number="7"
FT   exon            3213..3217
FT                   /number="8"
FT   UTR             3218..3314
SQ   Sequence 3314 BP; 639 A; 950 C; 1020 G; 705 T; 0 other;
     cagaagcaga ggggtcaggg cgaagtccca gggccccagg cgtggctctc agggtctcag        60
     gccccgaagg cggtgtatgg attggggagt cccagccttg gggattcccc aactccgcag       120
     tttcttttct ccctctccca acctatgtag ggtccttctt cctggatact cacgacgcgg       180
     acccagttct cactcccatt gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg       240
     gtcgcggttc taaagtccgc acgcacccac cgggactcag attctcccca gacgccgagg       300
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggctct ggccctgacc       360
     cagacctggg cgggtgagtg cggggtcggg agggaaacgg cctctgtggg gagaagcaac       420
     gggcccgcct ggcgggggcg caggacccgg gaagccgcgc cgggaggagg gtcgggcggg       480
     tctcagccac tcctcgtccc caggctctca ctccatgagg tatttcttca catccgtgtc       540
     ccggcccggc cgcggggagc cccgcttcat cgcagtgggc tacgtggacg acacgcagtt       600
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       660
     gcaggagggt ccggagtatt gggacgggga gacacggaaa gtgaaggccc actcacagac       720
     tcaccgagtg gacctgggga ccctgcgcgg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgacctc tcatccccca cggacgggcc aggtcgccca       840
     cagtctccgg gtccgagatc cgccccgaag ccgcgggacc ccgagaccct tgccccggga       900
     gaggcccagg cgcctttacc cggtttcatt ttcagtttag gccaaaaatc cccccaggtt       960
     ggtcggggcg gggcggggct cgggggaccg ggctgaccgc ggggtccggg ccaggttctc      1020
     acaccgtcca gaggatgtat ggctgcgacg tggggtcgga ctggcgcttc ctccgcgggt      1080
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt      1140
     ggaccgcggc ggacatggta gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg      1200
     cggagcagtt gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg      1260
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctccctgat      1320
     cgcctgtaga tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1380
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1440
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1500
     ctgaaggaat gacgggaaga cgatccctcg aatactgatg agtggttccc tttgacacac      1560
     acaggcagca gccttgggcc cgtgactttt cctctcaggc cttgttctct gcttcacact      1620
     caatgtgtgt gggggtctga gtccagcact tctgagtcct tcagcctcca ctcaggtcag      1680
     gaccagaagt cgctgttccc tcttcaggga ctagaatttt ccacggaata ggagattatc      1740
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct cccttcccca tcccaggtgt      1800
     cctgtccatt ctcaagatag ccacatgtgt gctggaggag tgtcccatga cagatgcaaa      1860
     atgcctgaat gatctgactc ttcctgacag acgcccccaa aacgcatatg actcaccacg      1920
     ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac cctgcggaga      1980
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      2040
     ccaggcctgc aggggatgga accttccaga agtgggcggc tgtggtggtg ccttctggac      2100
     aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc ctcaccctga      2160
     gatggggtaa ggagggagac gggggtgtca tgtcttttag ggaaagcagg agcctctctg      2220
     acctttagca gggtcagggc ccctcacctt cccctctttt cccagagccg tcttcccagc      2280
     ccaccatccc catcgtgggc atcattgctg gcctggttct ctttggagct gtgatcactg      2340
     gagctgtggt cgctgctgtg atgtggagga ggaagagctc aggtggggaa ggggtgaagg      2400
     gtgggtctga gatttcttgt ctcactgagg gttccaagac ccaggtagaa gtgtgccctg      2460
     cctcgttact gggaagcacc acccacaatt atgggcctac ccagcctggg ccctgtgtgc      2520
     cagcacttac tcttttgtaa agcacctgtt aaaatgaagg acagatttat caccttgatt      2580
     acagcggtga tgggacctga tcccagcagt cacaagtcac aggggaaggt ccctgaggac      2640
     cttcaggagg gcggttggtc caggacccac acctgctttc ttcatgtttc ctgatcccgc      2700
     cctgggtctg cagtcacaca tttctggaaa cttctctgag gtccaagact tggaggttcc      2760
     tctaggacct taaggccctg actcctttct ggtatctcac aggacatttt cttcccacag      2820
     atagaaaagg agggagctac tctcaggctg caagtaagta tgaaggaggc tgatgcctga      2880
     ggtccttggg atattgtgtt tgggagccca tgggggagct cacccacccc acaattcctc      2940
     ctctagccac atcttctgtg ggatctgacc aggttctgtt tttgttctac cccaggcagt      3000
     gacagtgccc agggctctga tgtgtctctc acagcttgta aaggtgagag cctggagggc      3060
     ctgatgtgtg ttgggtgttg ggcggaacag tggacacagc tgtgctatgg ggtttctttc      3120
     cattggatgt attgagcatg cgatgggctg tttaaagtgt gacccctcac tgtgacagat      3180
     acgaatttgt tcatgaatat ttttttctat agtgtgagac agctgccttg tgtgggactg      3240
     agaggcaaga gttgttcctg cccttccctt tgtgacttga agaaccctga ctttgtttct      3300
     gcaaaggcac ctgc                                                        3314
//