Dbfetch

ID   HLA08416; SV 1; standard; DNA; HUM; 264 BP.
XX
AC   HLA08416;
XX
SV   HLA08416.1
XX
DT   31-JUL-2012 (Rel. 3.10.0, Created, Version 1)
DT   10-NOV-2017 (Rel. 3.30.0, Last Updated, Version 1)
XX
DE   HLA-DPB1*140:01, Human MHC Class II sequence (partial)
XX
KW   Human MHC; HLA; Class II; HLA-DPB1; Allele; HLA-DPB1*140:01;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.30.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-264
RX   PUBMED; 23020589.
RA   Deng ZH, Xu YP, Wang DM;
RT   "Characterization of the novel HLA-DPB1*140:01 allele identified by
RT   sequence-based typing.";
RL   Tissue Antigens 80:549-551(2012).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JX291163; JX291163.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..264
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Oriental"
FT                   /cell_line="7551101236"
FT   CDS             1..264
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-DPB1"
FT                   /allele="HLA-DPB1*140:01"
FT                   /product="MHC Class II HLA-DPB1*140:01 sequence"
FT                   /translation="NYLFQGRQECYAFNGTQRFLERYIYNREELVRFDSDVGEFRAVTE
FT                   LGRPEAEYWNSQKDILEEKRAVPDRMCRHNYELDEAVTLQRP"
FT   exon            1..264
FT                   /number="2"
SQ   Sequence 264 BP; 62 A; 66 C; 97 G; 39 T; 0 other;
     agaattacct tttccaggga cggcaggaat gctacgcgtt taatgggaca cagcgcttcc        60
     tggagagata catctacaac cgggaggagc tcgtgcgctt cgacagcgac gtgggggagt       120
     tccgggcggt gacggagctg gggcggcctg aggcggagta ctggaacagc cagaaggaca       180
     tcctggagga gaagcgggca gtgccggaca ggatgtgcag acacaactac gagctggacg       240
     aggccgtgac cctgcagcgc ccag                                              264
//