spacer

EBI Dbfetch

ID   HLA08411; SV 1; standard; DNA; HUM; 822 BP.
XX
AC   HLA08411;
XX
SV   HLA08411.1
XX
DT   31-JUL-2012 (Rel. 3.10.0, Created, Version 1)
DT   22-APR-2015 (Rel. 3.20.0, Last Updated, Version 1)
XX
DE   HLA-A*26:78, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-A; Allele; HLA-A*26:78;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IMGT/HLA Release Version 3.20.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence for as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; AB733013; AB733013.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..822
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Oriental"
FT                   /cell_line="JMDP01K0130"
FT   CDS             <1..822>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*26:78"
FT                   /product="MHC Class I HLA-A*26:78 sequence"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDRNTRNVKAHSQTHRVDLGTLRGYYNQSEDGSHTIQRMYGCDVGP
FT                   DGRFLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWETAHEAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLRCWALSFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHVQHEGLPKPLTLRW"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
FT   exon            547..822
FT                   /number="4"
SQ   Sequence 822 BP; 166 A; 249 C; 286 G; 121 T; 0 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accggaacac acggaatgtg aaggcccact cacagactca ccgagtggac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggacg gttctcacac catccagagg atgtatggct       300
     gcgacgtggg gccggacggg cgcttcctcc gcgggtacca gcaggacgct tacgacggca       360
     aggattacat cgccctgaac gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccca gcgcaagtgg gagacggccc atgaggcgga gcagtggaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacggacgc ccccaagacg catatgactc accacgctgt ctctgaccat gaggccaccc       600
     tgaggtgctg ggccctgagc ttctaccctg cggagatcac actgacctgg cagcgggatg       660
     gggaggacca gacccaggac acggagctcg tggagaccag gcctgcaggg gatgggacct       720
     tccagaagtg ggcgtctgtg gtggtgcctt ctggacagga gcagagatac acctgccatg       780
     tgcagcatga gggtctgccc aagcccctca ccctgagatg gg                          822
//


spacer
spacer