Dbfetch

ID   HLA08366; SV 1; standard; DNA; HUM; 546 BP.
XX
AC   HLA08366;
XX
SV   HLA08366.1
XX
DT   31-JUL-2012 (Rel. 3.10.0, Created, Version 1)
DT   10-NOV-2017 (Rel. 3.30.0, Last Updated, Version 1)
XX
DE   HLA-B*52:01:14, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-B; Allele; HLA-B*52:01:14;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.30.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ739484; JQ739484.0.
DR   EMBL; JQ867322; JQ867322.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00004195"
FT                   /cell_line="HG00006596"
FT   CDS             join(1..270,271..546)
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*52:01:14"
FT                   /product="MHC Class I HLA-B*52:01:14 sequence"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
SQ   Sequence 546 BP; 113 A; 173 C; 189 G; 71 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctcc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg ggtctcacac ttggcagacg atgtatggct       300
     gcgacgtggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       360
     aagattacat cgccctgaac gaggacctga gctcctggac cgcggcggac accgcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgaggcgga gcagctgaga gcctacctgg       480
     agggcctgtg cgtggagtgg ctccgcagac acctggagaa cgggaaggag acgctgcagc       540
     gcgcgg                                                                  546
//