Dbfetch

ID   HLA08338; SV 2; standard; DNA; HUM; 2959 BP.
XX
AC   HLA08338;
XX
SV   HLA08338.2
XX
DT   31-JUL-2012 (Rel. 3.10.0, Created, Version 1)
DT   14-JUL-2016 (Rel. 3.25.0, Last Updated, Version 2)
XX
DE   HLA-B*08:56:02, Human MHC Class I sequence
XX
KW   Human MHC; HLA; Class I; HLA-B; Allele; HLA-B*08:56:02;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.25.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ277294; JQ277294.0.
DR   EMBL; KC991054; KC991054.0.
DR   EMBL; KF840747; KF840747.0.
DR   EMBL; KF882431; KF882431.0.
DR   EMBL; LN832564; LN832564.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2959
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="DKMS-LSL-B-420"
FT                   /cell_line="HG00004160"
FT                   /cell_line="HG00007124"
FT                   /cell_line="HG00008092"
FT                   /cell_line="HG00008093"
FT   CDS             join(285..357,486..755,1002..1277,1850..2125,2219..2335,
FT                   2777..2809,2916..2959)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*08:56:02"
FT                   /product="MHC Class I HLA-B*08:56:02 sequence"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFDTAMSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIFKTNTQTDRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKDTLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQSTVPIVGIVAGLAVLAVVVIGAVVAAVMCRRKSSGGK
FT                   GGSYSQAACSDSAQGSDVSLTA"
FT   UTR             1..284
FT   exon            285..357
FT                   /number="1"
FT   intron          358..485
FT                   /number="1"
FT   exon            486..755
FT                   /number="2"
FT   intron          756..1001
FT                   /number="2"
FT   exon            1002..1277
FT                   /number="3"
FT   intron          1278..1849
FT                   /number="3"
FT   exon            1850..2125
FT                   /number="4"
FT   intron          2126..2218
FT                   /number="4"
FT   exon            2219..2335
FT                   /number="5"
FT   intron          2336..2776
FT                   /number="5"
FT   exon            2777..2809
FT                   /number="6"
FT   intron          2810..2915
FT                   /number="6"
FT   exon            2916..2959
FT                   /number="7"
SQ   Sequence 2959 BP; 546 A; 897 C; 931 G; 585 T; 0 other;
     gatcaggacg aagtcccagg tcccggacgg ggctctcagg gtctcaggct ccgagggccg        60
     cgtctgcaat ggggaggcgc agcgttgggg attccccact cccctgagtt tcacttcttc       120
     tcccaacttg tgtcgggtcc ttcttccagg atactcgtga cgcatcccca cttcccactc       180
     ccattgggtg tcggatatct agagaagcca atcagcgtcg ccggggtccc agttctaaag       240
     tccccacgca cccacccgga ctcagagtct cctcagacgc cgagatgctg gtcatggcgc       300
     cccgaaccgt cctcctgctg ctctcggcgg ccctggccct gaccgagacc tgggccggtg       360
     agtgcgggtc gggagggaaa tggcctctgc cgggaggagc gaggggaccg caggcggggg       420
     cgcaggacct gaggagccgc gccgggagga gggtcgggcg ggtctcagcc cctcctcgcc       480
     cccaggctcc cactccatga ggtatttcga caccgccatg tcccggcccg gccgcgggga       540
     gccccgcttc atcgcagtgg gctacgtgga cgacacgcag ttcgtgaggt tcgacagcga       600
     cgccgcgagt ccgagagagg agccgcgggc gccgtggata gagcaggagg ggccggagta       660
     ttgggaccgg aacacacaga tcttcaagac caacacacag actgaccgag agagcctgcg       720
     gaacctgcgc ggctactaca accagagcga ggccggtgag tgaccccggc ccggggcgca       780
     ggtcacgact ccccatcccc cacggacggc ccgggtcgcc ccgagtctcc gggtccgaga       840
     tccgcctccc tgaggccgcg ggacccgccc agaccctcga ccggcgagag ccccaggcgc       900
     gtttacccgg tttcattttc agttgaggcc aaaatccccg cgggttggtc ggggcggggc       960
     ggggctcggg gggacggggc tgaccgcggg gccggggcca gggtctcaca ccctccagag      1020
     catgtacggc tgcgacgtgg ggccggacgg gcgcctcctc cgcgggcata accagtacgc      1080
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcctgga ccgcggcgga      1140
     caccgcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcaggacag      1200
     agcctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga      1260
     cacgctggag cgcgcgggta ccaggggcag tggggagcct tccccatctc ctataggtcg      1320
     ccggggatgg cctcccacga gaagaggagg aaaatgggat cagcgctaga atgtcgccct      1380
     cccttgaatg gagaatggca tgagttttcc tgagtttcct ctgagggccc cctcttctct      1440
     ctagacaatt aagggatgac gtctctgagg aaatggaggg gaagacagtc cctagaatac      1500
     tgatcagggg tcccctttga cccctgcagc agccttggga accgtgactt ttcctctcag      1560
     gccttgttct ctgcctcaca ctcagtgtgt ttggggctct gattccagca cttctgagtc      1620
     actttacctc cactcagatc aggagcagaa gtccctgttc cccgctcaga gactcgaact      1680
     ttccaatgaa taggagatta tcccaggtgc ctgcatccgc tggtgtctgg gttctgtgcc      1740
     ccttccccac cccaggtgtc ctgtccattc tcaggctggt cacatgggtg gtcctagggt      1800
     gtgccatgag agatgcaaag cgcctgaatt ttctgactct tcccatcaga ccccccaaag      1860
     acacacgtga cccaccaccc catctctgac catgaggcca ccctgaggtg ctgggccctg      1920
     ggcttctacc ctgcggagat cacactgacc tggcagcggg atggcgagga ccaaactcag      1980
     gacactgagc ttgtggagac cagaccagca ggagatagaa ccttccagaa gtgggcagct      2040
     gtggtggtgc cttctggaga agagcagaga tacacatgcc atgtacagca tgaggggctg      2100
     ccgaagcccc tcaccctgag atggggtaag gagggggatg aggggtcata tctcttctca      2160
     gggaaagcag gagcccttca gcagggtcag ggcccctcat cttcccctcc tttcccagag      2220
     ccgtcttccc agtccaccgt ccccatcgtg ggcattgttg ctggcctggc tgtcctagca      2280
     gttgtggtca tcggagctgt ggtcgctgct gtgatgtgta ggaggaagag ctcaggtagg      2340
     gaaggggtga ggggtggggt ctgggttttc ttgtcccact gggggtttca agccccaggt      2400
     agaagtgttc cctgcctcat tactgggatg cagcatccac acaggggcta acgcagcctg      2460
     ggaccctgtg tgccagcact tactcttttg tgcagcacat gtgacaatga aggacggatg      2520
     tatcaccttg gtggttgtgg tgttggggtc ctgattccag cattcatgag tcaggggaag      2580
     gtccctgcta aggacagacc ttaggagggc agttggtcca ggacccacac ttgctttcct      2640
     cgtgtttcct gatcctgcct tgggtctgta gtcatacttc tggaaattcc ttttgggtcc      2700
     aagacgagga ggttcctcta agatctcatg gccctgcttc ctcccagtcc cctcacaggg      2760
     cattttcttc ccacaggtgg aaaaggaggg agctactctc aggctgcgtg taagtgatgg      2820
     gggtgggagt gtggaggagc tcacccaccc cataattcct cctgtcccac gtctcctgcg      2880
     ggctctgacc aggtcctgtt tttgttctac tccaggcagc gacagtgccc agggctctga      2940
     tgtgtctctc acagcttga                                                   2959
//