Dbfetch

ID   HLA01971; SV 2; standard; DNA; HUM; 3094 BP.
XX
AC   HLA01971;
XX
SV   HLA01971.2
XX
DT   31-JUL-2004 (Rel. 2.7.0, Created, Version 1)
DT   16-APR-2018 (Rel. 3.32.0, Last Updated, Version 2)
XX
DE   HLA-A*01:01:03, Human MHC Class I sequence
XX
KW   Human MHC; HLA; Class I; HLA-A; Allele; HLA-A*01:01:03;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.32.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-3094
RX   PUBMED; 16866888.
RA   Voorter CE, Groeneveld L, Visser D, van den Berg-Loonen EM;
RT   "Characterization of a new HLA-A allele, A*010103";
RL   Tissue Antigens 68:173-4(2006).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; AJ697951; AJ697951.0.
DR   EMBL; AJ697952; AJ697952.0.
DR   EMBL; AJ697953; AJ697953.0.
DR   EMBL; AJ697954; AJ697954.0.
DR   EMBL; GQ240343; GQ240343.0.
DR   EMBL; LT604086; LT604086.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3094
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="27720"
FT                   /cell_line="27785"
FT                   /cell_line="36595"
FT                   /cell_line="HN-33780-2"
FT   CDS             join(142..214,345..614,856..1131,1711..1986,2089..2205,
FT                   2648..2680,2823..2870,3040..3044)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*01:01:03"
FT                   /product="MHC Class I HLA-A*01:01:03 sequence"
FT                   /translation="MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGT
FT                   LRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMA
FT                   AQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYTQAASSDSAQGSDVSLTACKV"
FT   UTR             1..141
FT   exon            142..214
FT                   /number="1"
FT   intron          215..344
FT                   /number="1"
FT   exon            345..614
FT                   /number="2"
FT   intron          615..855
FT                   /number="2"
FT   exon            856..1131
FT                   /number="3"
FT   intron          1132..1710
FT                   /number="3"
FT   exon            1711..1986
FT                   /number="4"
FT   intron          1987..2088
FT                   /number="4"
FT   exon            2089..2205
FT                   /number="5"
FT   intron          2206..2647
FT                   /number="5"
FT   exon            2648..2680
FT                   /number="6"
FT   intron          2681..2822
FT                   /number="6"
FT   exon            2823..2870
FT                   /number="7"
FT   intron          2871..3039
FT                   /number="7"
FT   exon            3040..3044
FT                   /number="8"
FT   UTR             3045..3094
SQ   Sequence 3094 BP; 593 A; 889 C; 963 G; 649 T; 0 other;
     tcctggatac tcacgacgcg gacccagttc tcactcccat tgggtgtcgg gtttccagag        60
     aagccaatca gtgtcgtcgc ggtcgctgtt ctaaagtccg cacgcaccca ccgggactca       120
     gattctcccc agacgccgag gatggccgtc atggcgcccc gaaccctcct cctgctactc       180
     tcgggggccc tggccctgac ccagacctgg gcgggtgagt gcggggtcgg gagggaaacc       240
     gcctctgcgg ggagaagcaa ggggccctcc tggcgggggc gcaggaccgg gggagccgcg       300
     ccgggaggag ggtcgggcag gtctcagcca ctgctcgccc ccaggctccc actccatgag       360
     gtatttcttc acatccgtgt cccggcccgg ccgcggggag ccccgcttca tcgccgtggg       420
     ctacgtggac gacacgcagt tcgtgcggtt cgacagcgac gccgcgagcc agaagatgga       480
     gccgcgggcg ccgtggatag agcaggaggg gccggagtat tgggaccagg agacacggaa       540
     tatgaaggcc cactcacaga ctgaccgagc gaacctgggg accctgcgcg gctactacaa       600
     ccagagcgag gacggtgagt gaccccggcc cggggcgcag gtcacgaccc ctcatccccc       660
     acggacgggc caggtcgccc acagtctccg ggtccgagat ccaccccgaa gccgcgggac       720
     tccgagaccc ttgtcccggg agaggcccag gcgcctttac ccggtttcat tttcagttta       780
     ggccaaaaat ccccccgggt tggtcggggc ggggcggggc tcgggggact gggctgaccg       840
     cggggtcggg gccaggttct cacaccatcc agataatgta tggctgcgac gtggggccgg       900
     acgggcgctt cctccgcggg taccggcagg acgcctacga cggcaaggat tacatcgccc       960
     tgaacgagga cctgcgctct tggaccgcgg cggacatggc agctcagatc accaagcgca      1020
     agtgggaggc ggtccatgcg gcggagcagc ggagagtcta cctggagggc cggtgcgtgg      1080
     acgggctccg cagatacctg gagaacggga aggagacgct gcagcgcact ggtaccaggg      1140
     gccacggggc gcctccctga tcgcctatag atctcccggg ctggcctccc acaaggaggg      1200
     gagacaattg ggaccaacac tagaatatca ccctccctct ggtcctgagg gagaggaatc      1260
     ctcctgggtt tccagatcct gtaccagaga gtgactctga ggttccgccc tgctctctga      1320
     cacaattaag ggataaaatc tctgaaggag tgacgggaag acgatccctc gaatactgat      1380
     gagtggttcc ctttgacacc ggcagcagcc ttgggcccgt gacttttcct ctcaggcctt      1440
     gttctctgct tcacactcaa tgtgtgtggg ggtctgagtc cagcacttct gagtctctca      1500
     gcctccactc aggtcaggac cagaagtcgc tgttcccttc tcagggaata gaagattatc      1560
     ccaggtgcct gtgtccaggc tggtgtctgg gttctgtgct ctcttcccca tcccgggtgt      1620
     cctgtccatt ctcaagatgg ccacatgcgt gctggtggag tgtcccatga cagatgcaaa      1680
     atgcctgaat tttctgactc ttcccgtcag acccccccaa gacacatatg acccaccacc      1740
     ccatctctga ccatgaggcc accctgaggt gctgggccct gggcttctac cctgcggaga      1800
     tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag ctcgtggaga      1860
     ccaggcctgc aggggatgga accttccaga agtgggcggc tgtggtggtg ccttctggag      1920
     aggagcagag atacacctgc catgtgcagc atgagggtct gcccaagccc ctcaccctga      1980
     gatggggtaa ggagggagat gggggtgtca tgtctcttag ggaaagcagg agcctctctg      2040
     gagaccttta gcagggtcag ggcccctcac cttcccctct tttcccagag ctgtcttccc      2100
     agcccaccat ccccatcgtg ggcatcattg ctggcctggt tctccttgga gctgtgatca      2160
     ctggagctgt ggtcgctgcc gtgatgtgga ggaggaagag ctcaggtgga gaaggggtga      2220
     agggtggggt ctgagatttc ttgtctcact gagggttcca agccccagct agaaatgtgc      2280
     cctgtctcat tactgggaag caccttccac aatcatgggc cgacccagcc tgggccctgt      2340
     gtgccagcac ttactctttt gtaaagcacc tgttaaaatg aaggacagat ttatcacctt      2400
     gattacggcg gtgatgggac ctgatcccag cagtcacaag tcacagggga aggtccctga      2460
     ggacagacct caggagggct attggtccag gacccacacc tgctttcttc atgtttcctg      2520
     atcccgccct gggtctgcag tcacacattt ctggaaactt ctctggggtc caagactagg      2580
     aggttcctct aggaccttaa ggccctggct cctttctggt atctcacagg acattttctt      2640
     cccacagata gaaaaggagg gagttacact caggctgcaa gtaagtatga aggaggctga      2700
     tgcctgaggt ccttgggata ttgtgtttgg gagcccatgg gggagctcac ccaccccaca      2760
     attcctcctc tagccacatc ttctgtggga tctgaccagg ttctgttttt gttctacccc      2820
     aggcagtgac agtgcccagg gctctgatgt gtctctcaca gcttgtaaag gtgagagctt      2880
     ggagggcctg atgtgtgttg ggtgttgggt ggaacagtgg acacagctgt gctatggggt      2940
     ttctttgcgt tggatgtatt gagcatgcga tgggctgttt aaggtgtgac ccctcactgt      3000
     gatggatatg aatttgttca tgaatatttt tttctatagt gtgagacagc tgccttgtgt      3060
     gggactgaga ggcaagagtt gttcctgccc ttcc                                  3094
//