Dbfetch

ID   HLA01316; SV 3; standard; DNA; HUM; 3502 BP.
XX
AC   HLA01316;
XX
SV   HLA01316.3
XX
DT   31-AUG-2000 (Rel. 1.8.0, Created, Version 1)
DT   16-APR-2018 (Rel. 3.32.0, Last Updated, Version 3)
XX
DE   HLA-A*24:29, Human MHC Class I sequence
XX
KW   Human MHC; HLA; Class I; HLA-A; Allele; HLA-A*24:29;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.32.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-3502
RX   PUBMED; 12028541.
RA   Gans CP, Bradshaw DM, Jones PF, Mitton W, Koester R, Ng J, Hartzman RJ,
RA   Hurley CK;
RT   "Eight new HLA-A alleles associated with antigens in the A2 CREG";
RL   Tissue Antigens 59:133-5(2002).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; AF291843; AF291843.1.
DR   EMBL; AF291844; AF291844.1.
DR   EMBL; AH009764; AH009764.1.
DR   EMBL; AJ537477; AJ537477.0.
DR   EMBL; AJ537478; AJ537478.0.
DR   EMBL; AJ537479; AJ537479.0.
DR   EMBL; AJ537480; AJ537480.0.
DR   EMBL; LT908420; LT908420.0.
DR   EMBL; MF474196; MF474196.0.
DR   EMBL; MG189555; MG189555.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3502
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Caucasoid"
FT                   /cell_line="443/01"
FT                   /cell_line="AN00927"
FT                   /cell_line="GN00379"
FT                   /cell_line="NT01473"
FT                   /cell_line="NT01549"
FT   CDS             join(301..373,504..773,1015..1290,1870..2145,2248..2364,
FT                   2807..2839,2982..3029,3198..3202)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24:29"
FT                   /product="MHC Class I HLA-A*24:29 sequence"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETRKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTVPIVGIIAGLVLLGAVITGAVVAAVMWRRNSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   UTR             1..300
FT   exon            301..373
FT                   /number="1"
FT   intron          374..503
FT                   /number="1"
FT   exon            504..773
FT                   /number="2"
FT   intron          774..1014
FT                   /number="2"
FT   exon            1015..1290
FT                   /number="3"
FT   intron          1291..1869
FT                   /number="3"
FT   exon            1870..2145
FT                   /number="4"
FT   intron          2146..2247
FT                   /number="4"
FT   exon            2248..2364
FT                   /number="5"
FT   intron          2365..2806
FT                   /number="5"
FT   exon            2807..2839
FT                   /number="6"
FT   intron          2840..2981
FT                   /number="6"
FT   exon            2982..3029
FT                   /number="7"
FT   intron          3030..3197
FT                   /number="7"
FT   exon            3198..3202
FT                   /number="8"
FT   UTR             3203..3502
SQ   Sequence 3502 BP; 673 A; 1017 C; 1060 G; 752 T; 0 other;
     cagaagcaga ggggtcaggg cgaagtccca gggccccagg cgtggctctc agggtctcag        60
     gccccgaagg cggtgtatgg attggggagt cccagccttg gggattcccc aactccgcag       120
     tttcttttct ccctctccca acctatgtag ggtccttctt cctggatact cacgacgcgg       180
     acccagttct cactcccatt gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg       240
     gtcgctgttc taaagtccgc acgcacccac cgggactcag attctcccca gacgccgagg       300
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc       360
     cagacctggg caggtgagtg cggggtcggg agggaaacgg cctctgcggg gagaagcaag       420
     gggcccgcct ggcgggggcg caagacccgg gaagccgcgc cgggaggagg gtcgggcggg       480
     tctcagccac tcctcgtccc caggctccca ctccatgagg tatttctcca catccgtgtc       540
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       600
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       660
     gcaggagggg ccggagtatt gggacgagga gacacggaaa gtgaaggccc actcacagac       720
     tgaccgagag aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc gggtcgccca       840
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       900
     gaggcccagg cgccttaacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       960
     ggtcggggcc gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc      1020
     acaccctcca gatgatgttt ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt      1080
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt      1140
     ggaccgcggc ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccatgtgg      1200
     cggagcagca gagagcctac ctggagggca cgtgcgtgga cgggctccgc agatacctgg      1260
     agaacgggaa ggagacgctg cagcgcacgg gtaccagggg ccacggggcg cctacctgat      1320
     cgcctgtagg tctcccgggc tggcctccca caaggagggg agacaattgg gaccaacact      1380
     agaatatcgc cctccctctg gtcctgaggg agaggaatcc tcctgggttt ccagatcctg      1440
     taccagagag tgactctgag gttccgccct gctctctgac acaattaagg gataaaatct      1500
     ctgacggaat gacggaaaga cgatccctcg aatactgatg actggttccc tttgacaccg      1560
     gcagcagcct tgggaccgtg acttttcctc tcaggccttg ttctctgctt cacactcaat      1620
     gtgtgtgggg gtctgagtcc agcacttctg agtccctcag cctccactca ggtcaggacc      1680
     agaagtcgct gttccctcct cagggaatag aagattatcc caggtgcctg tgtccaggct      1740
     ggtgtctggg ttctgtgctc tcttccccat cccgggtgtc ctgtccattc tcaagatggc      1800
     cacatgcatg ctggtggagt gtcccatgac agatgcaaaa tgcctgaatt ttctgactct      1860
     tcccgtcaga cccccccaag acacatatga cccaccaccc catctctgac catgaggcca      1920
     ctctgagatg ctgggccctg ggcttctacc ctgcggagat cacactgacc tggcagcggg      1980
     atggggagga ccagacccag gacacggagc ttgtggagac caggcctgca ggggatggaa      2040
     ccttccagaa gtgggcagct gtggtggtac cttctggaga ggagcagaga tacacctgcc      2100
     atgtgcagca tgagggtctg cccaagcccc tcaccctgag atggggtaag gagggagatg      2160
     ggggtgtcat gtctcttagg gaaagcagga gcctctctgg agacctttag cagggtcagg      2220
     gcccctcacc ttcccctctt ttcccagagc catcttccca gcccaccgtc cccatcgtgg      2280
     gcatcattgc tggcctggtt ctccttggag ctgtgatcac tggagctgtg gtcgctgctg      2340
     tgatgtggag gaggaacagc tcaggtggag aaggggtgaa gggtggggtc tgagatttct      2400
     tgtctcactg agggttccaa gccccagcta gaaatgtgcc ctgtctcatt actgggaagc      2460
     accatccaca atcatgggcc gacccagcct gggccctgtg tgccagcact tactcttttg      2520
     taaagcacct gtgacaatga aggacagatt tatcaccttg attatggcgg tgatgggacc      2580
     tgatcccagc agtcacaagt cacaggggaa ggtccctgac gacagatctc aggagggcga      2640
     ttggtccagg gcccacatct gctttcttca tgtttcctga tcctgccctg ggtctgcagt      2700
     cacacatttc tggaaacttc tctggggtcc aagactagga ggttcctcta ggaccttaag      2760
     gccctggctc ctttctggta tctcacagga cattttcttc ccacagatag aaaaggaggg      2820
     agctactctc aggctgcaag taagtatgaa ggaggctgat gcctgaggtc cttgggatat      2880
     tgtgtttggg agcccatggg ggagctcaac caccccacaa ttcctcctct agccacatct      2940
     tctgtgggat ctgaccaggt tctgtttttg ttctacccca ggcagtgaca gtgcccaggg      3000
     ctctgatgtg tctctcacag cttgtaaagg tgagagcttg gagggcctga tgtgtgttgg      3060
     gtgttgggcg gaacagtgga cacagctgtg ctatggggtt tctttgcatt ggatgtattg      3120
     agcatgcgat gggctgttta aagtgtgacc cctcactgtg acagatatga agttgttcat      3180
     gaattttttt tctatagtgt gagacagctg ccttgtgtgg gactgagagg caagagttgt      3240
     tcctgccctt ccctttgtga cttgaagaac cctgactttg tttctgcaaa ggcacctgca      3300
     tgtgtctgtg ttcatgtagg cataatgtga ggaggtgggg agaccacccc acccccatgt      3360
     ccaccatgac cctcttccca cgctgacctg tgctccctcc ccaatcatct ttcctgttgc      3420
     agagaggtgg ggctgaggtg tctccatctc tgtctcaact tcatggtgca ctgagctgta      3480
     acttcttcct tccctattaa aa                                               3502
//