Dbfetch

ID   HLA00793; SV 2; standard; DNA; HUM; 552 BP.
XX
AC   HLA00793;
XX
SV   HLA00793.2
XX
DT   03-MAR-1995 (Rel. 1.0.0, Created, Version 1)
DT   19-JAN-2018 (Rel. 3.31.0, Last Updated, Version 2)
XX
DE   HLA-DRB1*12:03:02, Human MHC Class II sequence (partial)
XX
KW   Human MHC; HLA; Class II; HLA-DRB1; Allele; HLA-DRB1*12:03:02;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   IPD-IMGT/HLA Release Version 3.31.0
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IPD-IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/ipd/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
RN   [1]
RP   1-552
RX   PUBMED; 8851733.
RA   Hashemi S, Couture C, Buyse I, Cole R, Aye MT;
RT   "Sequence analysis of three novel HLA-DRB1 alleles: DRB1*1113, DRB1*1114
RT   and DRB1*12032";
RL   Tissue Antigens 47:155-8(1996).
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official allele sequence as approved by the
CC   WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; KX453667; KX453667.0.
DR   EMBL; X83455; X83455.1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..552
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Caucasoid"
FT                   /cell_line="BY01302"
FT                   /cell_line="T00341"
FT   CDS             join(<1..270,271..552)
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*12:03:02"
FT                   /product="MHC Class II HLA-DRB1*12:03:02 sequence"
FT                   /translation="RFLEYSTGECYFFNGTERVRLLERHFHNQEELLRFDSDVGEFRAV
FT                   TELGRPVAESWNSQKDILEDRRAAVDTYCRHNYGVVESFTVQRRVHPKVTVYPSKTQPL
FT                   QHHNLLVCSVSGFYPGSIEVRWFRNGQEEKTGVVSTGLIHNGDWTFQTLVMLETVPRSG
FT                   EVYTCQVEHPSVTSPLTVEW"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..552
FT                   /number="3"
SQ   Sequence 552 BP; 121 A; 142 C; 179 G; 110 T; 0 other;
     cacgtttctt ggagtactct acgggtgagt gttatttctt caatgggacg gagcgggtgc        60
     ggttactgga gagacacttc cataaccagg aggagctcct gcgcttcgac agcgacgtgg       120
     gggagttccg ggcggtgacg gagctggggc ggcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaagacagg cgcgccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag tccatcctaa ggtgactgtg tatccttcaa       300
     agacccagcc cctgcagcac cacaacctcc tggtctgttc tgtgagtggt ttctatccag       360
     gcagcattga agtcaggtgg ttccggaatg gccaggaaga gaagactggg gtggtgtcca       420
     cgggcctgat ccacaatgga gactggacct tccagaccct ggtgatgctg gaaacagttc       480
     ctcggagtgg agaggtttac acctgccaag tggagcaccc aagcgtgaca agccctctca       540
     cagtggaatg ga                                                           552
//