spacer

EBI Dbfetch

ID   HLA08237   standard; DNA; HUM; 270 BP.
XX
AC   HLA08237;
XX
DT   30-JUN-2012 (Rel. 3.9.0, Created, Version 1)
DT   12-JUL-2012 (Rel. 3.10.0, Sequence Updated, Version 1)
DT   07-JUN-2013 (Rel. 3.12.0, Current Release, Version 1)
XX
DE   HLA-DRB1*04:119N, Human MHC Class II sequence (partial)
XX
KW   Human MHC; HLA; Class II; HLA-DRB1; Allele; DRB1*04:119N;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official sequence for DRB1*04:119N, as
CC   approved by the WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JN119558; JN119558.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00004053"
FT   CDS             <1..270>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*04:119N"
FT                   /product="MHC Class II HLA-DRB1*04:119N sequence"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNX"
FT   exon            1..270
FT                   /number="2"
SQ   Sequence 270 BP; 60 A; 64 C; 98 G; 48 T; 0 other;
     cacgtttctt ggagcaggtt aaacatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactaggggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer