spacer

EBI Dbfetch

ID   HLA08249   standard; DNA; HUM; 546 BP.
XX
AC   HLA08249;
XX
DT   30-JUN-2012 (Rel. 3.9.0, Created, Version 1)
DT   12-JUL-2012 (Rel. 3.10.0, Sequence Updated, Version 1)
DT   14-APR-2014 (Rel. 3.16.0, Current Release, Version 1)
XX
DE   HLA-A*29:02:12, Human MHC Class I sequence (partial)
XX
KW   Human MHC; HLA; Class I; HLA-A; Allele; A*29:02:12;
XX
OS   Homo Sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Vertebrata; Mammalia; Eutheria; Primates;
OC   Catarrhini; Hominidae; Homo.
XX
CC   --------------------------------------------------------------------------
CC   Copyrighted by the IMGT/HLA Database, Distributed under the Creative
CC   Commons Attribution-NoDerivs License, see;
CC   http://www.ebi.ac.uk/imgt/hla/licence.html for further details.
CC   --------------------------------------------------------------------------
XX
CC   --------------------------------------------------------------------------
CC   The sequence below is the official sequence for A*29:02:12, as
CC   approved by the WHO Nomenclature Committee for Factors of the HLA System.
CC   Any cross references may differ from the sequence shown below.
CC   --------------------------------------------------------------------------
XX
DR   EMBL; JQ436608; JQ436608.0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..546
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT                   /ethnic="Unknown"
FT                   /cell_line="HG00004078"
FT   CDS             <1..546>
FT                   /codon_start=1
FT                   /partial
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*29:02:12"
FT                   /product="MHC Class I HLA-A*29:02:12 sequence"
FT                   /translation="SHSMRYFTTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDLQTRNVKAQSQTDRANLGTLRGYYNQSEAGSHTIQMMYGCDVGS
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /number="2"
FT   exon            271..546
FT                   /number="3"
SQ   Sequence 546 BP; 108 A; 163 C; 196 G; 79 T; 0 other;
     gctcccactc catgagatat ttcaccacat ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac agcgacgccg       120
     cgagccagag gatggagccg cgggcaccgt ggatagagca ggaggggccg gagtattggg       180
     acctgcagac acggaatgtg aaggcccagt cacagactga ccgagcgaac ctggggaccc       240
     tgcgcggcta ctacaaccag agcgaggccg gttctcacac catccagatg atgtatggct       300
     gcgacgtggg gtcggacggg cgcttcctcc gcgggtaccg gcaggacgcc tacgacggca       360
     aggattacat cgccttgaac gaggacctgc gctcttggac cgcggcggac atggcggctc       420
     agatcaccca gcgcaagtgg gaggcggccc gtgtggcgga gcagttgaga gcctacctgg       480
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       540
     gcacgg                                                                  546
//


spacer
spacer