Help - Help - ClustalW2 Sequence Input Errors

Two or more of your sequences may have the same name. Please note that the sequence names (first 30 characters) are significant to the program.
For example:
```
>test1
aslkjdlaksjldkajs
>test1
alksjdlakjsdlkajsddas
```

A set of sequences in different formats has been used as input. For example:

>seq1
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDD
>seq3
seq2
PVAEERGLMSQPLMETCHSVGAAYLESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGLAGPAEP
ELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
>seq4
msalltaagl lflgmlqafp tdrplkttca gdlshypgea arnccyqcps glsptqpcpr
gpahcrkqca pdyyvnedgk ctacvtclpg lvekapcsgn spricecqpg mhcctpavns
carcklhcsg eevvkspgta kkdticelps sgsgpncsnp gdrktltsha tpqamptles

All input sequence must be in the same format. The sequence separators every 10 aa in seq3 and seq4 are not allowed in the f asta format specification. Please note that this kind of input is not allowed by the program.

Sequences with spaces (deletions) will have the same affect as above.

Sequences with illegal characters as for example:

>badsequence
*SNERNVCN*WFVYWADQL*WIELKCFA*HICNSG*LQRYNKPKNNQPIWGGIKRRCSS*
HLVWLLSDTYRVG*SGMX

A single sequence as input. You need at least two sequences to generate an alignment.
Alignments which are not in a recognised format (aln is the recommended!) and/or that have cut&pasted with space column s in the begining. The output of the results page is appropriate for generating phylogentic tree as long as you choose aln a s the output format for the alignment.
Illegal characters in the input. This could be cause by cuting & pasting from a word processing program. Please note that the input window and the upload form are not designed to cope with non-asc ii characters.